PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009603221.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 516aa    MW: 57612.3 Da    PI: 7.4917
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009603221.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1054.1e-33207264260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkver+  d++++ei+Y+g+Hnh+k
  XP_009603221.1 207 EDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERCL-DGQITEIVYKGNHNHPK 264
                     7****************************************.***************85 PP

2WRKY106.71.2e-33365423159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Cts+gCpv+k+ver+++d + v++tYeg+Hnh+
  XP_009603221.1 365 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSPGCPVRKHVERASQDIRSVITTYEGKHNHD 423
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-28197265IPR003657WRKY domain
PROSITE profilePS5081123.273201265IPR003657WRKY domain
SuperFamilySSF1182905.49E-25203265IPR003657WRKY domain
SMARTSM007743.9E-36206264IPR003657WRKY domain
PfamPF031065.4E-25207263IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-37350425IPR003657WRKY domain
SuperFamilySSF1182904.18E-29357425IPR003657WRKY domain
PROSITE profilePS5081138.595360425IPR003657WRKY domain
SMARTSM007741.1E-38365424IPR003657WRKY domain
PfamPF031069.3E-26366423IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
MAASSTIIDT SSMQNSSFSF PTSSSSFMTS SFTDLLACDD YPTKSKGLGD RIAERSGCGV  60
PKFKSLPPPS LPLSPPPFSP SSYFAIPPGL SPTELLDSPV LLSASNILPS PTTGTFPAQA  120
FNWKSSTNSR HQGVKQEDKN YSDFSFQPQF ASVSPSQTNP VPLGKQSWNY QESRKQNDEN  180
ANGTSELQSL KNNGQSNQYN KQSSRSEDGY NWRKYGQKQV KGSENPRSYY KCTFPNCPTK  240
KKVERCLDGQ ITEIVYKGNH NHPKPTQSTR RSSSLAIQPY NTQTNEIPDH QSTPENSSIS  300
FGDDDHEKSR SRGDDFDEEE EPDSKEPDPK RWKRESESEG LSAPGSRTVR EPRVVVQTTS  360
DIDILDDGYR WRKYGQKVVK GNPNPRSYYK CTSPGCPVRK HVERASQDIR SVITTYEGKH  420
NHDVPAARGS AINRPIAPTI TYNNAIPIRP SVTSQIPLPQ QSPFTLEMLH KPSNYNGFSG  480
YATSEDSYEN QLQDNNVFSR AKDEPRDDMF METLLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-37207426878Probable WRKY transcription factor 4
2lex_A1e-37207426878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9974040.0JN997404.1 Nicotiana tabacum WRKY transcription factor 8 (WRKY8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603221.10.0PREDICTED: probable WRKY transcription factor 26
SwissprotQ8S8P51e-119WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLH2EP690.0H2EP69_TOBAC; WRKY transcription factor 8
STRINGPGSC0003DMT4000432040.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22862460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-111WRKY DNA-binding protein 33